PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100189160011
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 284aa    MW: 31478.1 Da    PI: 9.4378
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100189160011genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.65e-32122175255
                       G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                   pr+rWt++LH++Fv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Ote100189160011|100189160011 122 PRMRWTSTLHAHFVHAVQLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 175
                                   9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.45E-15119176IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-28120176IPR009057Homeodomain-like
TIGRFAMsTIGR015576.1E-24122175IPR006447Myb domain, plants
PfamPF002494.3E-7123174IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0080060Biological Processintegument development
GO:0005618Cellular Componentcell wall
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MYFISNPVVT ANTASAAAPD LSLQISPPSL AIXXXXXXXX XXDTIGIPKK LMLDRSSATD  60
SGSSGSDLSH ENGFFNNQGH VEPTLRLGLE IDHRMLCGQY RPREMKRSSR GMKSVRTSVR  120
APRMRWTSTL HAHFVHAVQL LGGHERATPK SVLELMNVKD LTLAHVKSHL QMYRTVKSTD  180
KGTDIGSKLH TTTRIEDDDV ATLLAAPPFQ PSHTHRRPLC VDDRPSSQIL TGVDTKEYGV  240
ETTSGGRKLD SYNNSSDVLV NLEFTLGRSS WQQMEHSKSS LLRC
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00107PBMTransfer from AT5G42630Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011083778.13e-72PREDICTED: probable transcription factor KAN4 isoform X2
TrEMBLW9SP844e-63W9SP84_9R
STRINGVIT_18s0001g11390.t018e-59(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA122621822